PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA03g16380
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family HD-ZIP
Protein Properties Length: 821aa    MW: 89032.9 Da    PI: 6.4627
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA03g16380genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.76.3e-21116171156
                 TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 ++k +++t++q++eLe++F++n++p++++r eL k+l+L++rqVk+WFqNrR+++k
  CA03g16380 116 KKKYHRHTPYQIQELEACFKENPHPDEKARLELGKRLSLETRQVKFWFQNRRTQMK 171
                 79999************************************************999 PP

2START168.25.8e-533255491206
                 HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S.......EEEEEE CS
       START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla.......kaetle 83 
                 ela +a++elvk+a+ + p+W++s     e++n +e+ ++f++  +     ++ ea +a+g v  ++  lve+l+d++ qW  t+        ++ ++ 
  CA03g16380 325 ELAFAAMNELVKLAEISGPLWFRSLdgngEELNLEEYARSFPPCIGmkpanFTAEATKATGTVMINSLALVETLMDTS-QWVDTFSsivgrtsSMNLIS 422
                 57899**************************************9999*******************************.***********888888888 PP

                 EECTT...EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXH CS
       START  84 vissg...galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkgrlph 178
                   s g   g lql++ae+q+ s lvp R + f+R+++q+ +g+w++vdvSvd  q+ ++  +   +++lpSg++++++sng+skv+w+eh++++++++h
  CA03g16380 423 SSSGGgrnGNLQLIQAEFQVVSALVPvRQVKFLRFCKQHAEGVWAVVDVSVDAIQEGSQPREAGNCRRLPSGCIVQDLSNGYSKVIWIEHMEYDESTIH 521
                 87777****************************************************998899999********************************* PP

                 HHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
       START 179 wllrslvksglaegaktwvatlqrqcek 206
                 +++r ++ksgl +ga++w a+lqrqce+
  CA03g16380 522 NYYRAFIKSGLGFGAQRWIAALQRQCEC 549
                 **************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.2E-2290175IPR009057Homeodomain-like
SuperFamilySSF466891.54E-2098173IPR009057Homeodomain-like
PROSITE profilePS5007117.621113173IPR001356Homeobox domain
SMARTSM003891.3E-18115177IPR001356Homeobox domain
CDDcd000861.46E-18116173No hitNo description
PfamPF000461.8E-18116171IPR001356Homeobox domain
PROSITE profilePS5084837.786316552IPR002913START domain
SuperFamilySSF559612.47E-25318549No hitNo description
CDDcd088751.59E-95320548No hitNo description
PfamPF018521.5E-46325549IPR002913START domain
SMARTSM002342.0E-38325549IPR002913START domain
SuperFamilySSF559616.87E-12600809No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 821 aa     Download sequence    Send to blast
MSFGGFIGSS SGGGGGSGVS RLVGDSPYEA MPTATVAQSQ LITSSLPQSI FNSSPLSLAL  60
KPKMEGASDM SLLAENFGAV AMGRSDENDS RSPSDHLDGG GSGDDMEAHV GSSSRKKKYH  120
RHTPYQIQEL EACFKENPHP DEKARLELGK RLSLETRQVK FWFQNRRTQM KTQLERHENS  180
MLKQENDKLR LENMAMKEAM RGPTCHQCGG QAILGEIHME EHHLKIENAR LRDEYNRICL  240
MANKVLGRPL SSFPSPMPAG MGNFGLELAV GRNGFGAMNS VDAALPMGLD FGNGISSATI  300
PVISPRPIPN MTGIDVSFDK TVLMELAFAA MNELVKLAEI SGPLWFRSLD GNGEELNLEE  360
YARSFPPCIG MKPANFTAEA TKATGTVMIN SLALVETLMD TSQWVDTFSS IVGRTSSMNL  420
ISSSSGGGRN GNLQLIQAEF QVVSALVPVR QVKFLRFCKQ HAEGVWAVVD VSVDAIQEGS  480
QPREAGNCRR LPSGCIVQDL SNGYSKVIWI EHMEYDESTI HNYYRAFIKS GLGFGAQRWI  540
AALQRQCECL AIIMSSTVSS GDNAGTTSYF VGPSGRRSIA MLARRVTCNF CAGVCGTFYK  600
WEPIQSGSGE ETKLMMRKSV GELGEPSGVM LSATRTIWLP ITHQRLFDFL RNAQTRRQWD  660
VLFHGDAMHE IVHIAKGQDL GNSISLYRTN VTGSDGNQSS MLYLQDSCTD VSGSIVSYAA  720
VDTAQMNVVM SGGDSSCVTF LPSGFAIVPD CFGNSNGVTS NGMLEKEDNG GRNNGSFLTV  780
GYQILVNNLP GGNLTMESVN TINSFVSRTL GGIKTIFQCN *
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016564676.10.0PREDICTED: homeobox-leucine zipper protein ROC5 isoform X1
SwissprotQ9M2E80.0HDG1_ARATH; Homeobox-leucine zipper protein HDG1
TrEMBLM1B4R10.0M1B4R1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000370550.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA16262465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein